PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10013781m
Common NameCICLE_v10013781mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 917aa    MW: 102059 Da    PI: 6.679
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10013781mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.12.7e-31633690260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      dDgynWrKYGqK++kg+e+prsYY+Ct+ +Cpvkkkvers+   ++++i+Y++eHnhek
  Ciclev10013781m 633 DDGYNWRKYGQKPIKGNEYPRSYYKCTHVNCPVKKKVERSS-SAQITQIIYKNEHNHEK 690
                      8****************************************.9**************85 PP

2WRKY104.74.9e-33806864159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+ +dpk+v++tYeg+Hnh+
  Ciclev10013781m 806 LDDGYRWRKYGQKVVKGNPHPRSYYKCTNPGCNVRKHVERAPTDPKAVVTTYEGKHNHD 864
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF508144.24E-2374169IPR011038Calycin-like
Gene3DG3DSA:2.40.128.201.1E-3278254IPR012674Calycin
PfamPF122042.0E-1582407IPR022017Domain of unknown function DUF3598
SuperFamilySSF508144.24E-23196253IPR011038Calycin-like
Gene3DG3DSA:2.40.128.202.3E-40268412IPR012674Calycin
SuperFamilySSF508144.06E-31268412IPR011038Calycin-like
PROSITE profilePS5081124.604627691IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.7E-28627692IPR003657WRKY domain
SuperFamilySSF1182904.84E-25630691IPR003657WRKY domain
SMARTSM007748.8E-36632690IPR003657WRKY domain
PfamPF031061.2E-24633689IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.3E-36791866IPR003657WRKY domain
SuperFamilySSF1182903.79E-29798866IPR003657WRKY domain
PROSITE profilePS5081138.17801866IPR003657WRKY domain
SMARTSM007741.2E-39806865IPR003657WRKY domain
PfamPF031061.0E-25807864IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 917 aa     Download sequence    Send to blast
MASWVFNCHA LSFFLPSNPI TKQQPPNHNR TSTFPPNRSN PSPLPRTTLV RVKNSSSATA  60
AEQMKEEESM MSIDNLNRFF DLNKGNWSGS FHQFDGHGNL MQKVSTKLAV STYGEDELIS  120
LIQTLYIKQP PSSTSISGYE EEEPEWAEYK IKETNMFTVD KYQQIGFFPD ERAFSLRYQT  180
AGMLETVLRQ GVLGEDDTGE ESPKNLKLPS RQPAIVCENC LYSQEKDRRV RAFHIMDPKG  240
ILEMLLIFLE DRDGGVLFPP FLENVGDNKD RILPFLGKWK GHSITKRSGV YGATIAEADS  300
VALLKMDDKG QLIQDINSTS NTSDGQEVTT NVHWTGTISG NLVTFEGAYQ FTFLPGGMYM  360
GCPCDIAKSV AEFKSFHLEF GWVETPCKRQ RLVRTYDVEG LAVSSTYFSE IKFGKEDLTK  420
KKRPTIILPP RPSMESLYGS GLSPGPMTLV SSFFAEDLNN QSFSQLLAGA MASPLASKQA  480
QSFLVDYSKD GDGDGDDKSY GFKENRPTSL MIARSPLFTV PPGLSPSGLL NSPGFFSPQS  540
PFGMSHQQAL ATVTAQAFLA QSSMHMQAEY QPSLLSAPEE SLTCNLSVTP NEPSQQQMPH  600
SNSAPQSSMM EPLEVSHSDG KHMHPSAVDK PADDGYNWRK YGQKPIKGNE YPRSYYKCTH  660
VNCPVKKKVE RSSSAQITQI IYKNEHNHEK PQLSKRAKDS SDANENNNSQ ANPEPVLQGQ  720
TLYASSVLGS NQESAQAAPI HLADSSDSEE LGDAENRKEG DDDEPNTKRR QVSKKNIAVE  780
SEVVLSQKTV TEPKIIVQTR SEVDLLDDGY RWRKYGQKVV KGNPHPRSYY KCTNPGCNVR  840
KHVERAPTDP KAVVTTYEGK HNHDVPAAKN GSHCAPPRLK PNKVVTEKHP LLKDMDFGHD  900
DQRPVLLRLK EEQIIV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-40633867878Probable WRKY transcription factor 4
2lex_A3e-40633867878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.214280.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8276488e-77KT827648.1 Manihot esculenta WRKY transcription factor 73 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006431265.10.0hypothetical protein CICLE_v10013781mg
TrEMBLV4SZH60.0V4SZH6_9R
STRINGVIT_14s0108g01280.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-135WRKY DNA-binding protein 4